SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013710 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013710
Domain Number 1 Region: 112-214
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-26
Family PDZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013710   Gene: ENSMPUG00000013813   Transcript: ENSMPUT00000013927
Sequence length 328
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:10870966:10874752:1 gene:ENSMPUG00000013813 transcript:ENSMPUT00000013927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRARGATDPRGSRGGRDLPLQSGPRARQLLARLDARPLAARAAADVAALVRRTGATLR
LRPKAAVSVLDSADIEVTDSRLPNPTFVEHRPQHHRSVTLGTGTAPPQVTRSKACSASKL
LQTSGRFCVELVRDSTGFGLTLSGGQDSSGDAPLAVRGLLRNGPAQRCGRLQAGDLVLHI
NGESTRGLTHAQVVERIRTGGPRLRLVLRRPLESHPGEPEGAGGPEKGDGLPSPDRSPDP
GGPEVVRSHTVSASPLPHRRGSPEPSPEPLADCPAVPPPQRRTDDPNDRTPGSPGPWLVP
SEERLSRALGIPGAPQLALEMVAGRRRH
Download sequence
Identical sequences M3YQV1
ENSMPUP00000013710 XP_004755141.1.14098 ENSMPUP00000013710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]