SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014010 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014010
Domain Number 1 Region: 284-395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 465-572
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-20
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 3 Region: 578-643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000216
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 637-699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000668
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 704-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000773
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 224-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000278
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 107-225
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000105
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number 8 Region: 400-464
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000111
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014010   Gene: ENSMPUG00000014118   Transcript: ENSMPUT00000014233
Sequence length 861
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:4056737:4081481:1 gene:ENSMPUG00000014118 transcript:ENSMPUT00000014233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPTHPQARERPWSRESEPPVHHITAPLPPVPSLGSGERPNTTPPSRAWTPTQEGPGD
MGRPWAPEVKSQTLGLGVEGAITTSTASGDDEETTTTIVTTTITTVQPPGPCSWNFSGPE
GSLDSPTAPSSPTDVGLDCFYYISVYPGYGVEIKVQNISLREGETVTVEGLGGPDPLPLA
NQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPRRPAYGAVTVTS
LHPGGSARFRCATGYQLKGARLLTCLNATQPFWDFQEPVCIAACGGVTRNATTGRIVSPG
FPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEY
LPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPVG
TTVEFSCDPGYTLEQGSIIIECIDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEP
YSRGQDCIWGVHVEEDKRVLLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPRGHFKLF
TSMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGT
VVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLVSSPKFPVG
ATVQYICDQGFVLTGSPILTCHDRQASSPKWSDRAPKCLLEQLKPCHGLSTPENGAHSPE
KRLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYSGRSLDVA
KAPAPSSSLDAAHIAAAIFLPLVVMALLVGGVYLYFSRLQGKSPLRLPRTRPRPYDRITV
ESAFDNPTYEIGETKEYEVSI
Download sequence
Identical sequences M3YRQ0
XP_012908994.1.14098 ENSMPUP00000014010 ENSMPUP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]