SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014030 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014030
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 70-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014030
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00504
Family SCAN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014030   Gene: ENSMPUG00000014137   Transcript: ENSMPUT00000014253
Sequence length 534
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:8502836:8514439:-1 gene:ENSMPUG00000014137 transcript:ENSMPUT00000014253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQLLITLPMEASTCVKLRHPKKAKEGASLWEDVTKMFEGEVLFSQDADETQGESFEDQ
VTSRPSAVESQGLLTFKDISVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGYQLSKP
GVISQLEKGEEPWLIEREISGSPSSDLENKTETRESALKNDISWEELHHGLMKEQSTRGS
PLYSTLGRVSKCDKLESHQENQGIGDGKIPLTHKKTLTQERGRESNRFEKSINVSSKVIP
RPEGPPRIKDHKYDISRKRSRYNLDLINHSSSYTRMKTFECNICEKIFKQLIHFTEHMRI
HTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGE
KPYECGVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQVRHLRQHEIIHTGVKPYI
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYKCSHC
GKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRSTFSSDM
Download sequence
Identical sequences M3YRS0
ENSMPUP00000014030 ENSMPUP00000014030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]