SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014156 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000014156
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily DEATH domain 0.00288
Family Caspase recruitment domain, CARD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014156   Gene: ENSMPUG00000014264   Transcript: ENSMPUT00000014382
Sequence length 779
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:1511173:1556809:1 gene:ENSMPUG00000014264 transcript:ENSMPUT00000014382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQQL
SPQLTVHQPAEQPIQVQVQIQGQAPQPAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQ
IQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTA
SVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATG
TITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKE
KMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQ
QQPQQQTPQEQTPPPPPPQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEE
GLEVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARN
GEGEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGY
VLPSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKN
PSNPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLFKCPQSV
KGRNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQEAIAVANASTMH
Download sequence
Identical sequences M3YS46
XP_004760744.1.14098 ENSMPUP00000014156 ENSMPUP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]