SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014176 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014176
Domain Number 1 Region: 740-948
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000103
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 2 Region: 245-329
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000016
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1084-1240
Classification Level Classification E-value
Superfamily TPR-like 0.00000000237
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 4 Region: 977-1133
Classification Level Classification E-value
Superfamily TPR-like 0.0000000175
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Domain Number 5 Region: 191-251
Classification Level Classification E-value
Superfamily SH3-domain 0.0000015
Family SH3-domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014176
Domain Number - Region: 527-662
Classification Level Classification E-value
Superfamily TPR-like 0.000522
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014176   Gene: ENSMPUG00000014283   Transcript: ENSMPUT00000014402
Sequence length 1289
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:29248233:29300935:1 gene:ENSMPUG00000014283 transcript:ENSMPUT00000014402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFCIPGEPSLSWGPGKETPSKDPTVSSEFIASSEDKERCCLPQNMNPDLTLSFSVKS
RSQRCVNGLLQEAARRRLWALENEDQEVRALFQDLSARLVGIQSQRAQFLITFKTMEEIW
KFSTYLNLGYVSACLEHLLFDHKYWLSCRLVEDTEIQVSVDEKHLETIYLGLLIQEGHFF
CRAMCSVAPPAEKEGEYLTLCKKELISVKITDNESEWEGVSLVTGQRGLVPLSALEPLPL
PFHQWFLKNYPGSCGLSRKRDWTGSYQIGRGKCKAWKEYEREEKDELNFRRGESIEIIGF
VIPGLQWFIGKSTRSGEVGFVPTRNIDPESYSPMNKSSAFFSDEERCSLWVLGSDRKAEC
ASFLHKLAHTDIASVYRLSGFESIQNLPNDLSASQPEGFKEARPGRAWEEHQAVGSRQSS
SSEDSSLEEELLSAASDSYHLPEPDDLDDPELLVDLNTGQEEEEAENFAPMLAFLDHEGY
ADHFKSLYDFSFSFLTSSFYSFSEEDELVAYLEASRKWAKRGRRTWAHARLCFLLGRLSV
RKVKLSQARVYFEEAMYILDGTFEDLSLVAALYTNLAAIYLRQRLRHRGSALMEKAGALL
ACLPDRESSTKNELDVVAYVLRQGIVTGSCPLEARACFLAIRLLLSLGRHEEVLPFAERL
QLLSGHPPDLEATATVLSFLYDKKYLPHLTVASVQERGTQSGQGMSLPIWQVYLVLQNTT
KLLGVPSSSWGEISALACPALRQALAACEGQASWSTQRALCLILSKVYLQHRSPDGAIHY
LRQALVLGQLLSEQEAFESSLCLAWAYLLASQAKKALDILEPLLYSQKETDSITQKGVVH
NLLGLALQGEGRVNRAAKSYLRALNRAQEMGNVRNEAVTLANLGHLTLKSWAEQPAKDYF
LQAIRLYSELQTSMETDMELVQVLLWLAQVLVHGRQLASGRLCYEMALLFGLRHRHLKSQ
LQVTKSLCHFYSSVCPNPKACITYHEHWLTLAQQLRDREMEGRLLESLGQLYRNLNTARS
LRKSLTCIKESLRIFIDLGEKDKAAEAWLGAGRLHYLMQEDELVELYLQAAIQKALKSEE
PSLALKLYEEAGDVFFNGTRHRHCAVEYYRAGAIPLARRMKAMRTELRVFNKLTELQISL
EGYEKALEFATLAARLSTVIGDQKQELVAFHRLATVYYSLHMYEMAEDCYLKTLSLCSPW
LQSPKEALYYVKVYYRLGRLTFYQLKDAHDATEYFQLALAAAVLLGDEELQDSIRSRLDH
ICRSPLWHSSPSGRSSERARWLSGGGLAL
Download sequence
Identical sequences M3YS66
ENSMPUP00000014176 ENSMPUP00000014176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]