SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014221 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014221
Domain Number 1 Region: 277-374
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-25
Family PDZ domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014221
Domain Number - Region: 86-194
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014221   Gene: ENSMPUG00000014330   Transcript: ENSMPUT00000014449
Sequence length 463
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:12648999:12688533:-1 gene:ENSMPUG00000014330 transcript:ENSMPUT00000014449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPCPAGAGGGPGGASCAVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLKSELTETQAEKVVLEKEV
HDQLLQLHSIQLQLHAKTGQSVDSGTIKAKLSVPSVEELERELEANKKEKMKEAQLEAEV
KLLRRENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ
LEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGL
GISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGSNPGASCKDTSGEIKVLQ
GFNKKAVADGHENGDLGTSSETPVEDSASKLDDLHSLYHKKSY
Download sequence
Identical sequences M3YSB1
XP_004740138.1.14098 ENSMPUP00000014221 ENSMPUP00000014221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]