SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014270 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014270
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-51
Family FCH domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014270
Domain Number - Region: 646-781
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00034
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014270   Gene: ENSMPUG00000014378   Transcript: ENSMPUT00000014498
Sequence length 801
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897005.1:35979:147956:-1 gene:ENSMPUG00000014378 transcript:ENSMPUT00000014498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLA
NCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYN
AKCVEQERLRKEGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQD
IEETHLIHIKEIIESLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKER
PDFWEKESGPGNLGSGLIEFEECDPASAVEGVKPRKRKTFGLPGIIKKEKDAESVECPDA
DSLNIPDVDEEGYSIKPEANQNDTKENHFYSSSDSDSEDEEPKKYRIQIKPMHPNNSHHT
MASLDELKVSIGNITLSPAISRHSPVQMNRNSSSEELTKSKPCAASNEKGTSDLLAWDPL
FGPSLDSSSSASLTSSSSSARPTTPLSVGTIVPPPRPASRPKLTSGKLSGINEIPRPFSP
PITSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQDTLPVAVAL
TESVNAYFKGADPTKCIVKITGDMTISFPSGIIKVFTSNPSPAVLCFRVKNISRLEQILP
NAQLVFSDPSQCDSNTKDFWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSNGIQST
PLNLATYWKCSAGTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQSLPPAIWNA
EQMKAFWKLSGISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLSGVDIELVG
TGYRLSLVKKRFATGRYLADC
Download sequence
Identical sequences M3YSG0
ENSMPUP00000014270 ENSMPUP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]