SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014493 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014493
Domain Number 1 Region: 41-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014493   Gene: ENSMPUG00000014604   Transcript: ENSMPUT00000014726
Sequence length 275
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:21153872:21240762:1 gene:ENSMPUG00000014604 transcript:ENSMPUT00000014726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRLISWFFIILNFMEYIGSQNASRGRRQRRTHSNVSQGCQGGCATCSDYNGCLSCKPR
LFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVNIVHCEASEWSPWSPCMKKGKTCGFKRGTETRVREIT
QHPSAKGNLCPPTSETRKCTVQRKKCQKGERGKKGRERKRKKPNKEESKDAIPDNKGLEP
SRETPEQRENKDKQQQKKRKVQDKQQKSVSVSTVH
Download sequence
Identical sequences M3YT33
ENSMPUP00000014493 ENSMPUP00000014493 XP_004740208.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]