SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014525 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014525
Domain Number 1 Region: 270-331
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000196
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 62-85
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000589
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014525
Domain Number - Region: 355-384
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000288
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number - Region: 200-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00101
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014525   Gene: ENSMPUG00000014634   Transcript: ENSMPUT00000014758
Sequence length 468
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897206.1:597880:599340:1 gene:ENSMPUG00000014634 transcript:ENSMPUT00000014758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMEEPAAPSEASEAPGASAGAEAAAAGPAPLRTSRLRPAQAAGGGAGLSLLRGRSGGSW
TKQVTCRYYLHGLCKEGENCRYSHDLSGRQVAREGPGPADPGPSTAAQAETLPQEVAEAP
PAASSCSLPVIGLAAEGGSFEAGRDNAGLKAAGGAGAEGWENAIEFVPGQPYRGRMFPIV
PSAPPQSSVTEREQIAVGRGPPLCRDAAMGQCFRGESCMYLHGEICDMCGRQVLHPLDPV
QREGHIKACIEAHEEDMELSFAVQRSMDKVCGICMEVVYEKANPSDCRFGILSNCNHTYC
LKCIRRWRTDKQFGNRIVKSCPQCRVTSNFVIPSEFWVEEEEEKQKLIQQYKEAMSNKTC
RYFAESRGFCPFGENCFYKHADPEGPEEDPQRQGAGESGAHCSQLLEPTQVGEGEMPFKS
GKKELVMLRLADLLFKCFLSLADDELSLSEDQWDLLHYELENFFQFES
Download sequence
Identical sequences M3YT65
ENSMPUP00000014525 ENSMPUP00000014525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]