SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015013 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015013
Domain Number 1 Region: 42-158
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000109
Family Tetratricopeptide repeat (TPR) 0.00055
Further Details:      
 
Domain Number 2 Region: 316-398
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000353
Family PB1 domain 0.0064
Further Details:      
 
Domain Number 3 Region: 408-463
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000958
Family SH3-domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015013   Gene: ENSMPUG00000015123   Transcript: ENSMPUT00000015250
Sequence length 467
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897270.1:147836:243008:1 gene:ENSMPUG00000015123 transcript:ENSMPUT00000015250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKQQAWGSRGAPPPRGVQAVARGDWGCALRLFSGDPEPPARMCFNVGCVHLLAGDPEA
ALRALDQAVTKDAYMAVGFFQRGVANFQLERFQEALTDFRLALAQLRGNTAIDYTQLGLR
FKLKAWEVLFNVGAAQCRLGLWAEATRSLEEALSKGPEGAGDDLHTALGQLQKQVPLQPR
QVPRGEVFRPHRRHLEHLEPVDFLGKAKVVSSAIPDDEHEDSQPQQPQVRGADAEGRPGA
APRARDSGPCRTASPCGPRMPPEAETEVGSGRGVPRPRVEQVGRQVPPGLPVAGEPDSRP
SEDPLGAGGAAMEEPASLVTVTAQCAFTLALRVPRGVDLAGLRGLLSQALGRQAQRAQLS
YQDPSNKGRWVPLPGEEALQRAWRDAAAGTGVLQLQCRPQGAGGRAALYQVVAQHSYCAR
GPEDLALQRGDVVDVLCEVDQAWLEGHCGGHVGIFPKCFVVPAGQDV
Download sequence
Identical sequences M3YUK3
ENSMPUP00000015013 ENSMPUP00000015013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]