SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015224 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015224
Domain Number 1 Region: 646-722
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-20
Family SH3-domain 0.0000308
Further Details:      
 
Domain Number 2 Region: 1751-1821
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-19
Family SH3-domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1607-1691
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.00098
Further Details:      
 
Domain Number 4 Region: 882-1020
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000116
Family Fibronectin type III 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015224
Domain Number - Region: 785-869
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00265
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number - Region: 332-515
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015224   Gene: ENSMPUG00000015334   Transcript: ENSMPUT00000015463
Sequence length 1850
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:14070979:14095896:1 gene:ENSMPUG00000015334 transcript:ENSMPUT00000015463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLTPLPRLGDPRAMEPWALPAWQSWTPGQGSDPGGRTLSIADIPAALQGGELKPEESS
QPEGAQSPGAMGGTEPEGTKTGLPGLRHQAVSSRPSCPRREDEEVEALPKGKLNTGCGDR
PDLELLRALGELQQRCAILKEENQMLRKSSFPETEEKVRRLKRKNAELAVIAKRLEERAR
KLQETNLKVVSAPMPRPGASLELCQKALAHQRARDLSETASALLAKDKQIAALQRECREL
QARLTLVGKEGPQWLHVRDFDRLLRESQREVLRLQRQIALRNQQEPPRPIRPAGPAATAR
AGAPAPGAPGEATPQEDVENLPAVLGEPERQQRVQQLESELSKKRKKCESLEQEARKKQR
RCEELELQLREAQNENARLVEENSRLSGRATEKEQVEWENAELKGQLLGVTQERDSALRK
SQGLQSKLESLEQVLKHMREVAQRRQQLEVEHEQARLSLQEKQEEVRRLQQAQAEAKREH
EGAVQLLESTLDSMQVRVRELEEQCRTQTERFSLLAQELQAFRLHPGPLDLLTSALGYST
LGDHPPPPCCCSTPQPCRGSGPKDLDLPPGSPGRCTPKSSEPVPTTVTGVPRRTAKKAES
LSNSSRSESIHNSPKSCPTPEVDTASEVEELEADSVSLLPAASEGSRGGARIQVFLARYS
YNPFEGPNENPEAELPLTAGEYIYVYGDMDEDGFFEGELMDGRRGLVPSNFVERVSDDDL
LTSLPPELADLSHSSGPELSFLSGGGGGGSSGGQSSGGRSQPRPEDEAAGDELSLSPQPE
GLGGPPAVPYPRSLVVLRQLAHSVVLAWEPPPERLELRGYHICVNGELHQALGPGVPPKA
VLENLDLRAGPLHVSVQALTSQGSSDPLRCCLVVGTQARVGPSQLRVHRLTATSAEITWV
PGNSNLAHAVYLNGEECPPARPSTYWATFCHLRPGTLYQARVEAQLPPRESRGPGWERPE
QRAATLQFTTLPAGPPDAPLDVQIEPGPSPGIVVISWLPVTIDAVGTSNGVRVTGYAIYA
DGQKIMEVASPTAGSVLVELSQLQLLQVCSKVTVRTMSPHGESADSIPAPVPPALVAACL
PVTVSCPSPRPGSEARLPLAPASPGPGDPSSPLRRPDSCGTREPPGGPPARETPKGSHEE
EPIVSCSQKEAAAAVLGASEDGRASEPTGGARAPDPAALPLAKEDALRAPCSSQGALAQQ
VTCAEACLGGDTGSGPRPRAEREDAAELGGRLVNSLVDHGRNSDLSDIQEEEEEEEEEEL
GSTTCSFQKQVVGHSIRENGAKPQSQPEPFCETDSDEEILEQILELPLQQFCSKKLFSIP
EEEEEEDEEDEEEDEEDEERPGTGCSSRNPGPPEPAALGLSCDSSQPRGPGPCPLSPEPC
RAGDRLEDVPGLVGGTSRRRGSGSPEKPPNRRRSPDPREHCSRLLSNGPQASGRPGPTRE
RGSPTVGEGTKGVPDTGGRGRPPPSRRCSRGRAPESSLASCLSTRCLEISIEYDSEDEQE
AGSGGVSITSSCSLGDGEAWGTAPTGRSRGPLKANSGPNPYSRLLVWEKGEPERRGRSAT
GRAKEPPSRATETGEPRGQDGSGRRGPLRRGVQAPRACTTELAPLRSPPEEAMVYQDLPV
RVFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYRGEGDGRMGYVPCNM
VAEVAVDSPVERQQLFQRGYLSLDVLSEGSGNGPFVYATARTAGPPPKPRRSKKAEVDSA
AQPCAGHIQHVSSASLKSPRTMVAAFDYNPRESSPNMDVEAELPFQAGDIITVFGDMDDD
GFYYGELNGQRGLVPSNFLEGPGPEASSSDREPGTPQAESQRTRRRRVQC
Download sequence
Identical sequences M3YV64
XP_012909114.1.14098 ENSMPUP00000015224 ENSMPUP00000015224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]