SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015289 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000015289
Domain Number - Region: 418-454
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000998
Family LIM domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015289   Gene: ENSMPUG00000015399   Transcript: ENSMPUT00000015528
Sequence length 639
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:5132501:5197968:-1 gene:ENSMPUG00000015399 transcript:ENSMPUT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSHFRMTEEACRTRSQKRALERDPAEDDVESKKIKMERGLLSSDLNTDGDLRVTPEPG
AGPAQGLLRGAEVPTVGRCEGQAGDGPVDMRTSYSDMKSERRAPSPDVIVLSDNEQPASP
RVNGLTKEALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKETT
TQKPTGSAGSAVTTPPPLVRGTQNIPSGKPSLQTSSTRMPGSVIPPPLVRGGQQVSSKLG
PQASSQVVMPPLVRGAQQIHNIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVA
NVPNTSLLVNIPQPSPASLKGTTATSAQANSTPTSVASVVTSADSPASRQAAAKLALRKQ
LEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAAAVLSREP
YMCAQCKTDFTCRWREEKGGAIMCENCMASNQKKALKVEHTSRLKAAFVKALQQEQEIEQ
RLLQQGAAPTQAKAEPAAAPHPALKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGS
TTTPRGVLHTFSQSPKLQNAASATALVSRTGRHSERAVSTGKGNATTNWKKAPLSTGGAL
AFVSPSLAVHKTSSAVDRQREYLLDMIPPRSIPQSATWK
Download sequence
Identical sequences M3YVC9
XP_004760914.1.14098 XP_004760915.1.14098 ENSMPUP00000015289 ENSMPUP00000015289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]