SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015304 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015304
Domain Number 1 Region: 120-551
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.71e-74
Family Integrin alpha N-terminal domain 0.00000592
Further Details:      
 
Domain Number 2 Region: 847-1082
Classification Level Classification E-value
Superfamily Integrin domains 7.06e-42
Family Integrin domains 0.0035
Further Details:      
 
Domain Number 3 Region: 551-703
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-24
Family Integrin domains 0.0029
Further Details:      
 
Domain Number 4 Region: 705-841
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-21
Family Integrin domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015304   Gene: ENSMPUG00000015414   Transcript: ENSMPUT00000015543
Sequence length 1138
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:4324328:4354397:1 gene:ENSMPUG00000015414 transcript:ENSMPUT00000015543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPSLIPFLLPALGSDILVIPVWDGQRDNAWHRAHLSSQDSQSCFRWDSLPTQSVCPGP
CPPGPKHLLFSRNKTAVTSSQPKGEQAMGPGPRRSACVPRRMLCALALMVAAGGRVASAF
NLDTRFLVVKEAKNPGSLFGYSVALHRQTERQQRYLLLAGAPRDLALPDGYTNRTGAVYL
CPLTADKDDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSE
DQRRMVGKCYVRGNDLELDPTDDWQTYHNEMCNSNTDYLATGMCQLGTSGGFTHNTVYFG
APGAYNWQGNSYMIQRKDWDLSEYSYKDPEDQGNLYIGYTVQVGSAILHPKDITIVTGAP
RYRHMGAVFLLSQEAGGDLRRRQVLEGTQVGAYFGSAIALVDLNNDGWQDLLVGAPYYFE
RKEEVGGALYVFMNQAGTSFPAHPSLLLHGPSRSAFGFSVASIGDINQDGFQDIAVGAPF
EGLGKVYIYHSSSSGLLGRPQQVIQGEELGLPGLATFGYSLSGQMDVDGNSYPDLLVGSL
SDRIVLLRARPVINILHKTLVARPSVLDPAFCTATSCVQVELCFAYNQSAGNPNYRRNIT
LAYTLEADRDCRPPRLRFARSQSAVFHGFFSMPHTRCQKLELLLMDNVRDKLRPIIISMN
YSLPLRIPEHPRLGLRSLDPYPVLNQAQVLENHTEVQFQKECGQDNKCDSNLEMQAAFVS
ELGQPLSRLQYSRDGRKLLLSINVTNTPSRERAGEDAHEALLTLAVPPALLLSSVRPAGT
CQANETIVCELGNPFKRNQRMELLIAFEVTGVTLHTRELQAQLQLSTSSHQNNLWPVTLT
LLVDYTLRASLSIVNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQVSPMGEGLTALGS
LVLGLEWPYEVINGKWLLYPTEITIHGNGSWPCRPPGDLVNPLNLTLSVPGDRPPSPQRR
RRQLDPGGGPAPPPVTLAAAKKAKSETKLKCGGDQARCVWLECPIPDSPAITNVTVQARV
WNSTFIEDYRDFDRVSVSGWATLFLRTSIPTINMENKTLWFSVDIDSDLVEELPAEIELW
LVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY
Download sequence
Identical sequences M3YVE4
ENSMPUP00000015304 ENSMPUP00000015304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]