SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015319 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015319
Domain Number 1 Region: 3-40,80-112
Classification Level Classification E-value
Superfamily Chromo domain-like 6.04e-20
Family Chromo barrel domain 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015319   Gene: ENSMPUG00000015429   Transcript: ENSMPUT00000015558
Sequence length 351
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:157087:180255:1 gene:ENSMPUG00000015429 transcript:ENSMPUT00000015558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAGRPRRSEKALKTREDIV
ALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGA
APGKKTSGLQQKNVEVKTKKNKQKAPGNGDGGSTSETPPPPRKKRARVDPTVESEETFMN
RVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEY
AVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGA
MLAYTPLDEKSLALLLNYLHDFLKYLAKNSAALFSASDYEVAPPEYHRKAV
Download sequence
Identical sequences M3YVF9
ENSMPUP00000015319 ENSMPUP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]