SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015387 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015387
Domain Number 1 Region: 1307-1385
Classification Level Classification E-value
Superfamily Immunoglobulin 5.47e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 921-988
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000481
Family I set domains 0.083
Further Details:      
 
Domain Number 3 Region: 1207-1282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000562
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 706-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 478-528
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1477-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 759-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 815-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000981
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 1425-1483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number 13 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 1603-1658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 15 Region: 646-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000929
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015387   Gene: ENSMPUG00000015499   Transcript: ENSMPUT00000015628
Sequence length 1694
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:2377660:2718464:-1 gene:ENSMPUG00000015499 transcript:ENSMPUT00000015628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWQSSWWLLIWMVFMHSALLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNMHSDEEKDSNWDAWGSWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPAAPCALKCHARGQSLVVELAPKV
LDGTRCSSDSLDMCISGICQAVGCDRRLGSSAREDNCGVCAGNGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGNKKEHSFNSPGVFVIENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTVAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRGFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWVAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLKLHIKEECIIPIPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQT
ETELPEEECEGPELPTERPCLLQPCDEGPASREPDASLQEDGRMTYHWEYAGFTPCTATC
LGGRQEAIAVCLHTQTQSTVSDSLCDTLHRPPAMSQACNTEPCPPRWHTGSWGPCSAPCG
VGIQTREVDCLHPGESPAPAAECGDEKPHALQACNQFDCPPSWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPQITVGDWSKCSVSCGVGTQ
RRKQVCQRLTAKGRRVPLGEMMCRDLPGPPLVRPCQMPACTKAKPETKTQPGEQGPQILG
VQRVYIQTREEKRINLTVGGRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGHCLQNSKRLG
VTKSGSLKIHSLAAPDIGTYRCVAGPAWETEVLKLIGTDNRLIAPPALAESARPYPGMDH
EDANGLGATWQKMRQLWGSKNELYPEDGQVAKQPFWRALLGPCSNSAGNPPSWEFKNKQF
EAAVKHGAYSMETAQFEALIRNMSQLMETGEVSDDLASQAIYQLVAELAKVQPALAPWRG
AQEEASPAAQLRREARRKPQASEAESSGKLTFRPKGPVLRRQREPTSISFNKTINSRIGD
TVYITKRTEVINILCELITPRQATYTWTKDGTLFQPSEKIILAGMGKLQIRNPTKKEQGT
YGCSVANHLGSDVESSPVLYAEAPAISSTERNISQLGHRHLSVVVGGVVEAALGANVTIR
CPVKGVPQPNITWLKRGGSLSDNVSLLFNGSLLLQNVSLEHEGTYVCTATNALGKAVATS
VLHLLEQRHLDSKSVFPKDRKKHMLQVSNAGTDSSDPTGEPLPPEPFWELGNWTHCSATC
GHSGARVQRPRCVLADGQEVSEALCQHLPKPLAGFQPCNIRDCPSRWFTSPWSECSVSCG
EGFHSRQVTCKRTKANGTLQLMSPGACVPKERPPGRRPCSGHPCGQWVVEPGGQCPARCL
GRTGRLQPQHEVCQPHNSSDPRCDDRKRPSLRRNCSSGACDVCWRPGPWRPCTAACGRGF
QSRKVECVRSQSCRPVAERHCVQRKKPASWRHCLGPSCERHCSDTTHYCVFVKHLGLCSL
DLYKQRCCQSCQEG
Download sequence
Identical sequences M3YVM7
ENSMPUP00000015387 ENSMPUP00000015387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]