SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015393 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015393
Domain Number 1 Region: 11-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.64e-77
Family BAR domain 0.0000000668
Further Details:      
 
Domain Number 2 Region: 283-344
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015393   Gene: ENSMPUG00000015505   Transcript: ENSMPUT00000015634
Sequence length 347
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:2737191:2869485:-1 gene:ENSMPUG00000015505 transcript:ENSMPUT00000015634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLFSEKISGVEGTKLDDEFLDMERKIDITNKAVAEILSKATEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEGSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKL
RMRISAASSVPRREYKPRPIKRSPSELNGVSAASTAKTPGSNVPMDQPCCRGLYDFEPEN
QGELGFKEGDVITLTNQIDENWYEGLLHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences M3YVN3
ENSMPUP00000015393 ENSMPUP00000015393 XP_004763713.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]