SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015956 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015956
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000213
Family delta-Endotoxin, C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015956   Gene: ENSMPUG00000016063   Transcript: ENSMPUT00000016200
Sequence length 569
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:15506139:15542892:1 gene:ENSMPUG00000016063 transcript:ENSMPUT00000016200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSRYAVTSTGDHAEDQDG
DSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHGLGQVSKTDPSPKREAPT
MILFNVVFALRANADPSVINCLHTLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAM
ADASDGPQSPFHHILPKCKLARDLKEAYDSLCTSGVVRLHVNSWLEVSFCLPHKIHYAAS
SLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPLDCSPALVRVIKTTSAVKNLQQLAQ
DADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLAEQFSRQFPAHD
LPSVLAKFSLPVSLSEFRNPLAPPVQETQLIQMVVWMLQHRLLVQLHTYVCLMASPSEEE
PHAREDEVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPGGDSPLNK
RMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQL
LTLFDKFRSVLVVTAHEDPVIAVFQALLP
Download sequence
Identical sequences M3YX96
ENSMPUP00000015956 ENSMPUP00000015956 XP_004750994.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]