SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016071 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016071
Domain Number 1 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 103-164
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 282-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 420-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016071   Gene: ENSMPUG00000016176   Transcript: ENSMPUT00000016315
Sequence length 501
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897199.1:1303179:1311775:-1 gene:ENSMPUG00000016176 transcript:ENSMPUT00000016315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRSAPGRSGSQPRTPVGRAGTRAGPRRPPAATRMLHAPHPPRWVPTPPPPRPRPLPAR
VLAQLVGSGQTTDGLAERAPPRAAPTDQLLRTPAMAAVLLKARPKVPVSFEDVSVYFTKT
EWKLLDVQQRILYKTVMLENYHHLVSLGCLSTKPHLVSWLEQGEGPWTTDIWRTPATAKT
QTEGGIQTATSVSAQKRDPEELPGPDRRAGDYRPVAWPPGDAPEQGVRRAPSPQTGSSRG
DPPREKGPSSPSGAAGETRLRSSPRVGQERVPGRQGARGAEKRYVCQQCGRAFSRSSNLI
KHRVIHSGEKPYACGECGKLFRRSFALLEHRRTHSGERPYACGDCGKAFTRSSNLIKHQV
IHSGEKPYACPECGKPFRRRFALLEHRRTHSGERPYACGDCGKAFRRSSNLIEHQRTHRG
DKPYACGQCAKAFKGVSQLIHHQRSHSGDRPFTCQQCGKAFRGCSGLSQHQRAHSGERPY
AXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3YXL1
ENSMPUP00000016071 ENSMPUP00000016071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]