SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016156 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016156
Domain Number 1 Region: 330-398
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000523
Family Ran-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016156   Gene: ENSMPUG00000016260   Transcript: ENSMPUT00000016400
Sequence length 463
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897060.1:884790:905226:-1 gene:ENSMPUG00000016260 transcript:ENSMPUT00000016400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLVVPSGGGGFSGFGNGAGGKPLEGLSNGSGVNSAPPFSGARAATESKAAFGSVAANG
PTSLVDKKVLTPKTNGDSPQPSSSGPPSGAACPRSAYHKQLAALNCSVRDWIAKHVNANP
LCDLTPIFRDYERHLAGIEQQHGSGGGRGSEREAGPVPLATQSPSLFGAAKPQQDSAFPF
AGGRAEDGAERKTEPPAGAASASFSFGKKIDGSVLGSPNSGPLTGFSFSSGNSSFFGKDL
TQNKPASSPFSAKTLEVQAEGGTSDCKGGDEEASDEPPKVVVTEVKEEDAFYSKKCKLFY
KKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLALLAGEPQRAALLTVLPSLEGPREGS
GSSQRVLPPLQHPAERSDSAQHAVYPDGEEQRPDRVCPQPARR
Download sequence
Identical sequences M3YXU6
ENSMPUP00000016156 ENSMPUP00000016156 XP_004771186.1.14098 XP_012900569.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]