SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016335 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016335
Domain Number 1 Region: 97-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 2 Region: 243-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-24
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 
Domain Number 3 Region: 482-544
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 564-596,630-718
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000445
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016335   Gene: ENSMPUG00000016439   Transcript: ENSMPUT00000016580
Sequence length 751
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897060.1:4736291:4744945:-1 gene:ENSMPUG00000016439 transcript:ENSMPUT00000016580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGNHIPSASGPFSALTPSMWPQEILAKYTQKEESVEQPEFCYDEFGFRMDKEDGADPSP
GKLPGAALLEDPQQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHSM
RPQLWMRLSGALQKKRSSELSYREMVKNSSNDETIAAKQIEKDLLRTMPSNACFANVSSI
GVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAITEDLLPASYFST
TLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRVLLRLWD
LFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPSQIEDAELLLGEAMRLAG
SLTDVAVETQRRKHLAYLIADQGQLLGTTATTNLSQVVRRRTQRRKSGITSLLFGEDDLE
ALKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELSPDYSMESHQRDHENYVACSR
GHRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDE
RSKEYSIAGDDAVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGRE
VERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLIC
VGLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWEL
PVKREEEKQPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences M3YYC5
ENSMPUP00000016335 ENSMPUP00000016335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]