SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016406 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016406
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily RUN domain-like 5.1e-43
Family RUN domain 0.0026
Further Details:      
 
Domain Number 2 Region: 491-537
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000158
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016406
Domain Number - Region: 387-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0085
Family Extended AAA-ATPase domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016406   Gene: ENSMPUG00000016509   Transcript: ENSMPUT00000016651
Sequence length 544
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:1821137:1838844:1 gene:ENSMPUG00000016509 transcript:ENSMPUT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEGAVLTRNLKAAVSAILQGYGGPQRPVTDASAELHTLCGCLELLLQFDQKEQKSFLR
PRKDYWDFLCATLWRQRGSTEPARFILAQDKSKTPLAKGRAFIRFCLAQGQLAESLQLCL
LNPEVTRDWYGPRSPLVCPELREDLLDSLYALNGVAFDLDLQWPNLDEAWPMFSESCHSS
PRRTQGRRPKKTKDSPKQIPATYGDPTGAQPEEPHTSQAGLQAAPREDGLAGLPGAWQPK
HLLPFVEKEREDPKSLGPPRSTREPEGKELQQGSQGQGEGTNRAPKEVIGTEAEGRGVLP
GAEGTHKGETEWGDVHRLLASSPTGTIEDTMSGSWQKWKASSIGGMPGVLPDLGTKENST
PERQQEERGVTSVTRRKERAEVALQDVVKSLRRELRKTKEQARHQEQLLKEQEGELKTLQ
EQFSRCQEERDQLQTELEQKQQEAERRNAMYEEELGGQQDLVRAMKRRVLELIQEKDDLW
QKAQQLSSMAPGCCVDCSKIFGRLSRRYPCRLCGGLVCHACSVDYKKRERRCPPCSEKGE
VQSS
Download sequence
Identical sequences M3YYJ6
ENSMPUP00000016406 ENSMPUP00000016406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]