SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016493 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016493
Domain Number 1 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000946
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016493
Domain Number - Region: 136-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00834
Family Classic zinc finger, C2H2 0.069
Further Details:      
 
Domain Number - Region: 208-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0405
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016493   Gene: ENSMPUG00000016596   Transcript: ENSMPUT00000016738
Sequence length 695
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:2138936:2169885:-1 gene:ENSMPUG00000016596 transcript:ENSMPUT00000016738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLGPVSFRDVAVNFTQEEWQQLEPEQKTTYRDVMLENYSHLVSVGCHIIKPEVIIKL
EQGEEPWIVEGEFLPQSYPGDVWKADVLGERVQENESKYSRQAVSNNKTLIEERGNVLGK
TSNAETNPIPSRKMSYKCDSCEKSLKSISEYISSDGSYARMKPDECSACGKPLPQIKLEK
THPGDESYEFNQNGDAYSLNEESIYHNINILEKPFEYIECQKAFQKDTVFVNHMEEKPYK
WNESEIAFLQMSNLRVHERSHMELKPYECNACGKSFCKKSKFIIHQRTHTGEKPYECNQC
GKSFCQKGTLTVHQRTHTGEKPYECNECGKTFYQKLHLIQHQRTHSGEKPYECSYCGKSF
CQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCNECGKCFCRKS
TLTTHQRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMR
HQRVHTGEKPYECTECGKLFSQLSYLTIHHRTHSGVKPYECNECGKTFYQNSALCRHRRI
HKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECNECGKTFCQNSALNRHQRTHTGE
KAYECYECGKFFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYE
CNECGKKFYHKSAFNSHQRIHRRGNVSVLDVGRLL
Download sequence
Identical sequences M3YYT3
ENSMPUP00000016493 XP_004775063.1.14098 ENSMPUP00000016493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]