SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016498 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016498
Domain Number 1 Region: 23-156
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016498   Gene: ENSMPUG00000016602   Transcript: ENSMPUT00000016744
Sequence length 222
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896913.1:12356373:12616898:1 gene:ENSMPUG00000016602 transcript:ENSMPUT00000016744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECLGTRLNDISLGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWD
IHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATL
AIAEQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHG
FGSSKMSRAQTFPSYASEPSDETQALSRAGSYGFSSSSSLIQ
Download sequence
Identical sequences M3YYT8
ENSMPUP00000016498 ENSMPUP00000016498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]