SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016565 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016565
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily Immunoglobulin 7.08e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 127-233
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 252-339
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1351-1445
Classification Level Classification E-value
Superfamily Immunoglobulin 7.33e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 1621-1703
Classification Level Classification E-value
Superfamily Immunoglobulin 7.9e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 6 Region: 1813-1895
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 1163-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-16
Family I set domains 0.052
Further Details:      
 
Domain Number 8 Region: 798-892
Classification Level Classification E-value
Superfamily Immunoglobulin 8.73e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 890-985
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000024
Family I set domains 0.037
Further Details:      
 
Domain Number 10 Region: 1722-1808
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000702
Family I set domains 0.0043
Further Details:      
 
Domain Number 11 Region: 333-428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000745
Family I set domains 0.019
Further Details:      
 
Domain Number 12 Region: 1071-1157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000804
Family I set domains 0.06
Further Details:      
 
Domain Number 13 Region: 980-1075
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000262
Family I set domains 0.047
Further Details:      
 
Domain Number 14 Region: 722-811
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000312
Family I set domains 0.015
Further Details:      
 
Domain Number 15 Region: 1450-1535
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000431
Family I set domains 0.017
Further Details:      
 
Domain Number 16 Region: 1259-1344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000878
Family I set domains 0.021
Further Details:      
 
Domain Number 17 Region: 1542-1628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000291
Family I set domains 0.0043
Further Details:      
 
Domain Number 18 Region: 515-604
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000326
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 19 Region: 433-542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000026
Family I set domains 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016565
Domain Number - Region: 619-716
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000563
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016565   Gene: ENSMPUG00000016668   Transcript: ENSMPUT00000016811
Sequence length 1896
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:3046807:3065955:-1 gene:ENSMPUG00000016668 transcript:ENSMPUT00000016811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPIVVWEKGGQQLAASERLSF
PADGAEHGLLLSGALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASESEPQPAERPLPP
PGAGEGAPVFLAGPRSQWVLRGAQVVLTCQVGGLPAPALYWEKDGMALDEVWDSGHFTLE
PGRAEGGQGVSLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPENPPEDPDEA
PKPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLSDRRRLMYRDRDG
GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL
ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGVYLCEMRGRVRT
VANVTVKGPILKRLPRKLDVLEGENAVLLVETQEAGVEGRWSRDGEDLPATCQSSSGHMH
ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPVLAEMFKGHKNTVLLTWKP
PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRVCTVSEHGR
SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSHEPE
GQVEPGALRYRIEQKGLQHRLLLRAVQHQHSGALVGFSCPGVQDSAALTIQESPVHILSP
EDKVSLTFTTSERVVLTCELSRVDFPACWYKDGQEVEESESLVVKMDGRKHRLILPAAEV
RDSGEFECRTEGVSAFFSVTVRDPPVHILDPQEHVFVHAITSECVMLTCEVDREDAPVRW
YKDGQEVEESDLVVLEKEGTHHRLVLPAAQPPDGGEFQCVAGDERAYFTVTITDVSSWIV
YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV
QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEMTLIAVSLECVVLRCELSRQDAPV
RWYKDGLEVEESEALVLESDGPHRRLVLPAAQPEQGGEFVCDAGDDSAFFTVTVTAPPEK
IVHPAARSLDLQFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDTLLLGAEGPVRTLTL
PHAQPEDAGEYVCETRDEAVTFNVSVAEPPVQFLAPEASPAPLCVAPGEPVVLSCEVSRA
GALVFWSHNGSPVQEGEGLEFQAEGPRRILRIRAAELTHAGLYTCQSGTAPGAPSLSFTV
QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVRLEQA
GARQVLRVQGARSGDAGEYLCDTPQDSRIFLVSVEEPPQAKLVSELTPLTVHEGDDATFR
CEVSPPDAEVTWLRNGAVVTPGPQLEIGEHGLSRTLTVRGCQLNDAGTVTARAGGTATSA
RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAEAVRWLRAGEPLPHDSRMSMAQ
DGHVYRLFIRGVVLADQGTYGCESHHDRTLARLSVRPKQLRVLRPLEDMTIIEGGSATFQ
LELSQEGVAGEWARGGVRLQPGPKCHVHAEGRTHRLVLSSLGPADSGCVSFTVDSLRCAA
RLTVREAPVTIVRGLQDLEVTEGDTATLECELSQALADVTWEKDGCPLTPSPRLRLQALG
TRRLLQLRRCSPLDAGTYSCAVGAARAGPVRLVVCERNVSVLSELRSVRVREGDGATFEC
TVSEVETTGSWELGGRQLRPGGHVRIRQEGKKHILVLSELRPEDAGEVRFQAGPAQSVAQ
LEVEALPLQMCRRPPREKTVLVGRRAILEVTVSRSGGHVCWLREGVELCPGDKYELRSHG
PTHSLVIHDVRPEDQGTYSCQAGQDSAHTRLLVEGE
Download sequence
Identical sequences M3YZ05
ENSMPUP00000016565 ENSMPUP00000016565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]