SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016715 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016715
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily PX domain 3.79e-39
Family PX domain 0.0001
Further Details:      
 
Domain Number 2 Region: 151-210
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-19
Family SH3-domain 0.00038
Further Details:      
 
Domain Number 3 Region: 253-323
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-19
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 4 Region: 812-920
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-17
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 426-513
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1032-1113
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000814
Family SH3-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016715   Gene: ENSMPUG00000016820   Transcript: ENSMPUT00000016964
Sequence length 1115
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:1971155:2195100:1 gene:ENSMPUG00000016820 transcript:ENSMPUT00000016964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPI
EGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRF
FEARPEDVNPPKEDYGSSKRKSGADTNAEPMILEQYVVVSNYKKQENSELSLQAGEVVDV
IEKNESGWWFVSTSEEQGWVPATYLEAQNGTRDDSDINTSKTGEVSKRRKAHLRRLDRRW
TLGGMVNRQHSREEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWA
PASYLKKAKDDLPARKKNLAGPVEIIGNIMEISNLLNKKASGDKETPPAESEGPEAPITK
KEISLPILCNASNGSALGVPERSVSKLAQGSPAVARIAPQRAQISSPNLRTRPPPRRESS
LGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAEVIDKNSGGWWYVQIGEKEG
WAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEAEEGPAGSAESQDSPLKLKYEE
PEYDIPAFGFDSEPELSEEPTEDSGSGDRRPSQAHRPSPASSLQRARFRVGGSSEDVAPE
EETIYENEGFRPCAEDALSARRSSRDSQSPGGSPLSLARKNSPRSGSPKSSSLLKLKAEK
NAQAELGKNHSSASSSSITINTTCSSSSSSSSLSKNSGDLKPRSASDAGIRGTPPVGPKR
DADLKAGLTSCARAKPSVRPKPFLNRAESQSQEKMDISTLRRQLRPTGQLRGGLKGSKSE
DSELPPQAAFEGSSEGSRRGSADLITPPAATPPCPTKKGPEGQATSYTTCSAYQKVQDSE
ISFPAGVEVQVLEKLESGWWYVRFGELEGWAPSHYLVLGENEQPDPAGKEPDTVSPKNKQ
HEGKSDSLEKIEKRVQALNTVNQNKRATPPIPSKPPGGFSKTSAASAVKLRNGVRQVAVR
PQSVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLPERAAS
QGSDTPLLPGQRNGIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSM
EVLERNPNGWWYCQILDGAKPFKGWVPSNYLEKKN
Download sequence
Identical sequences M3YZF5
ENSMPUP00000016715 ENSMPUP00000016715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]