SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016718 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016718
Domain Number 1 Region: 39-331,514-575
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.91e-91
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.63e-57
Family GMC oxidoreductases 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016718   Gene: ENSMPUG00000016823   Transcript: ENSMPUT00000016967
Sequence length 594
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:3845632:3875182:-1 gene:ENSMPUG00000016823 transcript:ENSMPUT00000016967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVPRGWRVGRLGPWGAEGRKQPPSVRALASVGSRSGDEYSHVVVGAGSAGCVLARRLT
EDPDKRVLLLEAGPKDVLAGSKRLLWKIHMPAALVANLCDDRYNWCYHTEPQPGLDGRVL
YWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQREGAAGWDYAHCLPYFRKAQSHELGAGTY
RGGQGPLHVSRGKTNHPLHHAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIHQGKRWSA
ACAYLHPALGRPNLTAEAQTLVHRVLFEGTRAVGVEYVKNGQSHRVYAGAEVILSGGAIN
SPQLLMLSGVGNADDLRKLGIPVVCHLPGVGQNLQDHLEVYIQQACTRPITLHSAQKPLR
KVRIGLEWLWKFTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGTMRGTSVGWLKLRSANPQDHPVIQPNYLTTETDIHDFRQCVKLTREIFAQKALAP
FRGKELQPGSNVQSDEEIDAFVRAKADSAYHPSCTCKMGQPSDPMAVVDPQTRVLGVQNL
RVVDASIMPSVVSGNLNAPTIMIAEKAADIIRGQPALWDKDVPVYKPGTLATQR
Download sequence
Identical sequences M3YZF8
ENSMPUP00000016718 XP_004738257.1.14098 XP_012908401.1.14098 XP_012908406.1.14098 ENSMPUP00000016718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]