SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016777 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016777
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.59e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000994
Further Details:      
 
Domain Number 2 Region: 488-706
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.72e-55
Family Ankyrin repeat 0.0000115
Further Details:      
 
Domain Number 3 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 6.53e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 4 Region: 773-849
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000212
Family DEATH domain, DD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016777   Gene: ENSMPUG00000016882   Transcript: ENSMPUT00000017026
Sequence length 900
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:3186554:3194481:-1 gene:ENSMPUG00000016882 transcript:ENSMPUT00000017026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYDPALDGMIEYDDFKFDPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGGGSLGFFPSSLAYSPYPSGSAPMGCYPGGGGGAQMAAEAPRVAAGEE
AAEPSASPLTPHREPQAPDLLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRH
LLTAQDENGDTPLHLAIIHGQTSVIEQIAHVIYHARHLGVVNLTNHLHQTPLHLAVITGQ
TRVVSFLLQVGADPALLDRHGDSAVHLALRAGASAPDLLRTLLHSGVPAMHQLLHMPDFE
GLYPIHLAVHARSPECLDLLVDSGAEVEAAERQGGRTALHLATEMEELGLVTHLVTKLRA
NVNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADILAENEEPLCPLPSPPTSGSDSDSEG
PERDTRGSFRGHTPLDLTRSTKVKTLLLNAAQDATAPPLTPPSPAGPEPPLEDTALQNLE
HLLDGPGAQGSWAELAERLGLRSLVDTYRKTASPSGSLLRSYKLAGGDLAGLLGALSDMG
LEEGVRLLRGPEARDKLPSTEVKEDSAYGSESVEQEAEKLGSPPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences M3YZL7
ENSMPUP00000016777 ENSMPUP00000016777 XP_004749451.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]