SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016963 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000016963
Domain Number - Region: 134-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000668
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016963   Gene: ENSMPUG00000017071   Transcript: ENSMPUT00000017216
Sequence length 834
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896952.1:636989:752019:-1 gene:ENSMPUG00000017071 transcript:ENSMPUT00000017216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSKDFVVLPWGKPGNSIKLKYKNAQELRMEKVQLELENQQMEKKLQEFQSAWSKEKEER
ESSGYHWKSGRVGKLGNQSHTMSQNKKNIIKFSAGKVKLKLLKEQLQDPVKPQLNYKMAN
PSESKKSKIKGKVCGQCENKAALLVCLECGEDYCLGCFAKIHQKGALKLHRTTLLQAKSQ
MLSNVLDAAHRFIKEVNPDEPKGNNHSEEEISKSENKPKSLLQGSHSGVEVPTTKRAECS
HPKDRLLCEGSFDEEASAQSFPETLNQWRTGHQDDNEKQNPPAAKADSLEECEVQTNLKI
WREPLNIEFKEDSLSYMEKLWLKKHRRTPQEQLRNMLPNTFIPQCKTASEAQCSQNESDE
DSDVEETKVQYPAPFLPVEELNIERPEPSLKIVELDDTYEEEFEEPGDPVPYKVELADAD
SQQSCTFHEYQNTFLYETDIHQHHVSTKEKTDLLHLHLNNSSSYCKNNSKAGTSDTEFEI
IVDPDVYFPAIEKIGESSISERNFKDKMIDTESNQKSGDSCVSLESKASLPSIDLKKPSI
KEQLPQDIKESLEFSNLHERPNFEDSKATESPLLLQEIALRSKPITEQYQGLERFFVFDK
NERLNLLPSHSLECSYSSTRITTAGDREWIPDRSISTYADNAVTLGVQQSAQNPSMSRTQ
RKMGQISQRPSTANLSLSNSVKKSSSCLVSSHPRSRSAGARPLSRAASEISEIEYIDTTH
HTEPFLDGTADQQTLDSLEKELNVLRNLADPSEKLYSLTSEELPAFNNHSLNISQTTLDF
CKTSSARGLCAVEEWSSFERDTEAQSLLTLSESSTDEEEEDFLDKQHVIMLSWS
Download sequence
Identical sequences M3Z052
ENSMPUP00000016963 XP_004756557.1.14098 XP_012913737.1.14098 ENSMPUP00000016963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]