SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017048 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017048
Domain Number 1 Region: 150-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9e-47
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-27
Family DEATH domain, DD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017048   Gene: ENSMPUG00000017157   Transcript: ENSMPUT00000017302
Sequence length 580
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:33023477:33083148:1 gene:ENSMPUG00000017157 transcript:ENSMPUT00000017302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCYIYQLPAWVLDDLCRNMDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLQLYRAAQIVLNWHGQTHGPSLSGHAPARANLPPPSADDP
HSLKTDFPVSSDSKGFSTSIPKQETLVSQAEDSLFWSEADVVQATENFNQNHKISEGTFA
DIYKGQRHGTPFVFKKLREVAYSGPGSVEKFFQAEVQICRRCCHPNVLPLLGFCTGNQLC
SLIYPYMANGSLQDRLQGQGGTDALLWPQRASICSGLLRAVGHLHSLEIIHGNVKSSNVL
LDQTFTPKLAHPMAHLCPDNKRSRYTMMKTHLFQASAAYLPEDFIRVGQLTKRVDIFSCG
IVLAEVLTGIPAMDNNRSPVYLKDLLLSEIPSSTTSLCCRKTDMEKVMAMEICQRYLEKR
AGRLPEDCAEALAMATCLCLRRRNASLAEVCGYVAIVDKRLRGQETLLPWSGLSEVTGSS
SNTPEETDDVDNSSLDASYSMRVAPRAGAAASLPSTEDGEGRLQVCGGAQADSSAASASL
EPSQDETSWKIEINEAKKKLMENIVFYKEGKLDSIELFGP
Download sequence
Identical sequences M3Z0D7
XP_004738574.1.14098 ENSMPUP00000017048 ENSMPUP00000017048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]