SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017072 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017072
Domain Number 1 Region: 210-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-82
Family Nuclear receptor ligand-binding domain 0.000000000173
Further Details:      
 
Domain Number 2 Region: 106-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017072   Gene: ENSMPUG00000017181   Transcript: ENSMPUT00000017326
Sequence length 475
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:34948147:35081309:1 gene:ENSMPUG00000017181 transcript:ENSMPUT00000017326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFARADPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKN
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
MNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences M3Z0G0
ENSMPUP00000017072 XP_004738606.1.14098 ENSMPUP00000017072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]