SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017270 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017270
Domain Number 1 Region: 3956-4326
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-101
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2954-3045,3105-3330
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.4e-89
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 3 Region: 4463-4794
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-88
Family Hect, E3 ligase catalytic domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.18e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 5 Region: 2730-2912
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.32e-33
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2555-2632
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.44e-29
Family CPH domain 0.00066
Further Details:      
 
Domain Number 7 Region: 1864-1930
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 8 Region: 1207-1291
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000602
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017270
Domain Number - Region: 2456-2507
Classification Level Classification E-value
Superfamily UBA-like 0.000438
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3623-3713
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017270   Gene: ENSMPUG00000017380   Transcript: ENSMPUT00000017526
Sequence length 4840
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:9165775:9402918:1 gene:ENSMPUG00000017380 transcript:ENSMPUT00000017526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLAAQTRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELNQNGELPP
RKDDGVDTQSGTKKEDLNDKEKKDEEETPAPACRAKLILESWVWGKQPDVNELKECLSVL
VKEQQALAIQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISLPPVDK
KSSRPTGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGTIPLQDQHLALAILLELAVQ
RGTLSQMLSAILLLLQLWDSGTQETDNERSAQGTSAPLLPLLQRFQSIICSKDAPHTEGD
THLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVALASSAGVLSTVQAAAQAVLQSGWSVLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEASASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTIARLKDVARRISSCLDFEQHSRERTASLDLLLRFQRLLISKLYPGESIGQTSDISS
PELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGDFTGVLLPELVV
SIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQ
NCRNNEEVTQIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVV
ALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCS
HRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRV
PKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVTGVHKY
KWLKQNVQGLYPQSALLSTITEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLA
TKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWA
VQNIRNVLMDANAKFKELGIQPVPLQTITNENPSGPSLGTTPQARFLLVMLSMLTLQHGA
NNLNLLLNSGTLALTQTALRLIGPSCDNVEEDMNASARGASATVLEETRKETAPVQLPVS
GPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMG
KEGKYDLKLAELPTSTQPSAEDSDTEDDSEAEQIERNIHPTAMMLTSTVNLLQTLCLSAG
VHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVCREQHRSWCTLGFVRSIALTPHM
CAALSSPQWIALLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEK
LFGFLGSLLTTCSSDIPFLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLHSLGQW
NGLINKYINSQLHSVTHSCTGKPSEGALLEDYFPDSENLEVGGLMAVLAVIGGIDGRLRL
GGQVMHDEFGEGTVTRITPKGRITVQFSDMRMCRVCPLNQLKPLPAVAFSVTNLPFTEPM
LSVWAQLVNLAGSKLEKHKVKKSPKQGFAGQVDLDLLRGQQLKLYILKAGRALLSHQDQL
RQILSQPAVQEVTAAHSDDGGAASPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFD
KQELEAAALAVCQCLAVESTHPSSPVFEDCSSSEATTPVPVQHVRPVRAKKRKQSPAPAL
PIVVQLMEMGFPRRNIEFALKSLTGASGNAAGLPGVEALVGWLLDHADVQVTDLSDVDTG
SEECSDEEVVEDVDDSAYAVSTGAVVTESQTYKKRGDFLSNDDYAVYVRENIQVGMMVRC
CRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSPSHI
KIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELV
PSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTRKHNTRHTFGRINEPGQSAIF
CGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHW
IRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVSLLN
DCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGN
SGSLIRKKAAGLESAAMIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAG
GSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGNTPE
LALICRIKVGAKREPTSGSLGLTPYQSRSNCDKPRLIEALKTKRIRDIACGSSHSAALTS
SGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFS
WGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFR
LGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTV
NRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPS
DADSSAASNKISGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGA
LMPAGMIAPVECPSFSSSAPPSDASAMASPVNGEECVLAIDIEDRLSPNPWQEKRGEMIS
SEDAVTPSAVTPSASSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPEPQSL
DEFTSLLVADDTRVMVDLLKLSVCSRAGEKGRDVLSAVLSGMGTAYPQVADMLLELCVTE
LEDVATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDP
LTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAG
PKDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWA
LQRLRKLLTTEFGQSININRLLGDNDGEARALSFTGSALAALVKGLPEALQRQFEYEDPI
VRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLP
RLFLDEVAKKIRELMADSEPMDVLHESHDIFKREQDEQLVQWMNRRPDDWILSAGGSGTI
YGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAG
GRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHG
NRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKP
KLVEALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSL
TGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAI
ATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTL
AWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLD
ETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGL
AGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQ
NGLTPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGIAIRTGSPLSLNL
AEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQ
LSSKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMV
CGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIA
DFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTD
DYARIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences M3Z108
ENSMPUP00000017270 ENSMPUP00000017270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]