SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017286 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017286
Domain Number 1 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-23
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 4 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000036
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000263
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000255
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017286
Domain Number - Region: 242-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000492
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017286   Gene: ENSMPUG00000017396   Transcript: ENSMPUT00000017542
Sequence length 703
Comment pep:novel scaffold:MusPutFur1.0:GL897223.1:40298:60795:-1 gene:ENSMPUG00000017396 transcript:ENSMPUT00000017542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSQGQLTFRDVVIELSQEEWGCLTHTQRQLYRDVMLENYGHLCFLGLTVSKPDLITFL
EQEKQLWDMKRKETGGFHPAVSSHDTQSFLLKQSIQGSFQNGSMHRYKHSAVEILHLNRD
WDNDGESDGYQRFQRRQIQTKSTVFHENLTAPNGEGCKHLWKSSLLKSTVSAEQCVSVST
RSDQIFHHSNSWTDHLAHLESNLVHAENNDLSHLEDRTDLTLNQRFRNEKQSAQWDPFYR
GFTEESTLQNERRLLRGDRIAQCTESEKTLNQGSHAHRWVRTRFAENHYECDKCGEGIHP
SSNLSILPSGDSPHKDNECGNAHNHSSSVGDHQRIYEGKSPFTCNKPGTMFSPSSRPNRN
KTIPRGEETCIFKECCKSFDCHSTLSQFSRMHTGEKICKCKECSKPFKEPSSVKGHKPTH
TGGKPYKWAKGVKASTLSSTLPGSPQTHTGEKPYQCHICGKAFKSHSDVTQHHRVHTGEK
PYKCQECGKAFHRSSGLRQHHRLHTGQKPYQCHECGKTFNHSSVLTQHYRIHTGEKPYQC
QECDKAFRQSSGLLRHHRAHTGERPYKCKQCGKAFKMPSDIMKHHRIHTGEKPYKCNDCG
KAFMWVTSLTKHNRIHTGEKPYRCNKCGKAFHDSSRLTAHHRIHTGEKPYECEECGKTFM
WPSNLTRHRQIHKWRVIYRHNVIVKTSMAFSSFTSCQKFYIGD
Download sequence
Identical sequences M3Z124
ENSMPUP00000017286 ENSMPUP00000017286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]