SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017291 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017291
Domain Number 1 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 228-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000277
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017291   Gene: ENSMPUG00000017401   Transcript: ENSMPUT00000017547
Sequence length 475
Comment pep:novel scaffold:MusPutFur1.0:GL897223.1:733843:745643:-1 gene:ENSMPUG00000017401 transcript:ENSMPUT00000017547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLSQERLTFRDVAIEFSREEWECLDPAQRALYRDVMVENYRNLVSLNISTRCMNKELPP
KDNINNGELFQTLILKRRISHDFDFGLRVQQDGNKFETQWLCEEKNCKGMTTSHYKNLTC
REDQQHHKFCNDFPVKHSVSVRNSKSQYYKHDTSNNALKNKAGSSGNKYRNCLDNRLGLS
FHSHLAELQRFETQEEIHESNQVEKSTKKSSVSPLPKIPSSVKTNISNKYGKVLTHSSLQ
TQHQKTPKREKPYKCKECGKTFSHCSTLATHQRIHSEQKPYKCNDCGKVFNRFSNLTRHQ
RIHTGEKPYKCNVCGKDFMIRSHLWGHERIHTGEKPYKCDECGKAFSECSNLVQHKRIHS
GEKPYKCNQCGKEFITRSHLWGHERTHTGEKPYKCNECGKAFSGSSNLTQHKRIHAGEKP
YKCNVCDKAFSQNSSLTVHQRIHTGEKPYTCRECGKAFKQYSSLSRHQNIHRMKI
Download sequence
Identical sequences M3Z129
ENSMPUP00000017291 ENSMPUP00000017291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]