SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017377 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017377
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.13e-24
Family THAP domain 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017377   Gene: ENSMPUG00000017487   Transcript: ENSMPUT00000017633
Sequence length 218
Comment pep:known scaffold:MusPutFur1.0:GL896932.1:7506582:7516451:-1 gene:ENSMPUG00000017487 transcript:ENSMPUT00000017633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWIRLLRRKNFVPGKHTFLCSKHFEAS
CFDLTGQTRRLKMDAVPTIFDFCTHLKSMKLKSRNLLKKNNSCTPTGPSNLKSNISSQQV
LLEHSYAFRNPMEAKKRIIKLEKEIASLRKKMKTCLQKERRATRRWIKATCLVKNLEANN
ILPKGTSEHILPTALSSLPLEDFKILEPDQQDKTLPIL
Download sequence
Identical sequences M3Z1B5
ENSMPUP00000017377 ENSMPUP00000017377 XP_004752488.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]