SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017439 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017439
Domain Number 1 Region: 43-117
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.46e-34
Family PB1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 154-272
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-23
Family PDZ domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017439   Gene: ENSMPUG00000017551   Transcript: ENSMPUT00000017697
Sequence length 391
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:1518319:1530322:-1 gene:ENSMPUG00000017551 transcript:ENSMPUT00000017697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRDSRCTDKYNQMVICLLDRKAGALWDRNFRLSGPLLFCPLTFGAEFRRFSLERSKPGK
FEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEA
DYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVR
LYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVN
GIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGCVQQ
VEPSFEPEDEDSDEDDIVIEDNGMPQQIPKAVPNTESLESLTQIELNFESGQNGFIPSNE
VSLAPVASGTNTETHAPDQKLLEEDGTIITL
Download sequence
Identical sequences M3Z1H7
ENSMPUP00000017439 ENSMPUP00000017439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]