SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017476 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017476
Domain Number 1 Region: 634-829
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-73
Family Sec7 domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 407-580,1089-1475,1648-1755
Classification Level Classification E-value
Superfamily ARM repeat 6.19e-26
Family Armadillo repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017476   Gene: ENSMPUG00000017589   Transcript: ENSMPUT00000017735
Sequence length 1785
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:2865130:2966285:-1 gene:ENSMPUG00000017589 transcript:ENSMPUT00000017735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELERPIPSKPQSPVIQAATVSPKFSHLKQSQAQS
KPTTPEKTDLTNGEHASSGSGKVSSENGDAPRERGASLSGTDDGAQEVVKEILEDVVTSA
VKEAAQKRGLTEPEQVLGELECQEGAVPPAADENSQTNGIADDRQSLSSADNLESDAQGH
QVAARFSHILQKDAFLVFRSLCKLSMKPLAEGPPDPKSHELRSKVVSLQLLLSVLQNAGP
VFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKE
IFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKI
AQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERPTDQE
LGDGKGLDMARRSSVTSMESTLSSGTQMAVQDDPEQFEVIKQQKEIIEHGIELFNKKPKR
GIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSTRFNKEVMYAYVDQLDFCEK
EFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLT
TDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHTIATK
SAKQSVASEKQRRLLYNLEMEQMARTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTP
LLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSI
TEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRE
REGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGST
RLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGD
HFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIR
DMVIRCVAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTTIFQHHF
PAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVAP
GDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFR
IFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDN
EQLARSGTNCLENLVISNGEKFSPDVWDETCICMLDIFKTTIPHVLLTWRPAGMEEDSSE
KHLDMDLDRQSLSSIDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLELI
QTIDNIVFYPATSKKEDAEHMVAAQQDTLDAEIHIETEDQGMYKCMSSQHLFKLLDCLQE
SHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSWE
EIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYLC
EIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPGTLSPVW
Download sequence
Identical sequences M3Z1L4
XP_004746300.1.14098 ENSMPUP00000017476 ENSMPUP00000017476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]