SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017524 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017524
Domain Number 1 Region: 217-377
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.22e-62
Family DNA-binding protein LAG-1 (CSL) 0.00000503
Further Details:      
 
Domain Number 2 Region: 65-219
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.71e-57
Family DNA-binding protein LAG-1 (CSL) 0.0000385
Further Details:      
 
Domain Number 3 Region: 379-490
Classification Level Classification E-value
Superfamily E set domains 1.28e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017524   Gene: ENSMPUG00000017637   Transcript: ENSMPUT00000017783
Sequence length 530
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:5854800:5868300:-1 gene:ENSMPUG00000017637 transcript:ENSMPUT00000017783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPEGGEWGPSVAMDPVRATDPSAPPGPLTHLSLPDSSEARPQSGAHGRSLPGNWTRSSP
ERVMVLREGVRQCLQQQGAQTVRILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQ
GQAHQAGETGPTVCGYMGLDGTSGSAAETQKLNFEEQPDSREFGCAKTLYISDADKRKHF
RLVLRLVHRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVS
TRYLSVEDGAFVASARQWAAFTLHLADEHCSQGDFPPREGYVRYGSLVQLVCTVTGITLP
PMIIRKVAKQCALLDVDEPISQLHKCAFQFPGDPPGGVGTYLCLATDKVVQFQASPCPKE
ANRALLNDSSCWTIIGTEAVEFSFSTSMAWTREPVTPVPLLSTLELSGGGDVATLELHGE
NFHSGLKVWFGDVEAETMYRSPRSLVCVVPDIAAFGSDWRWLRTPITVPVSLVRADGLFY
PSAFSFTYTPEYSARPGPPGAPEPAPDADALLESIHHEFTRTNFHLFIQT
Download sequence
Identical sequences M3Z1R2
XP_004746415.1.14098 ENSMPUP00000017524 ENSMPUP00000017524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]