SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017612 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017612
Domain Number 1 Region: 101-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-55
Family DBL homology domain (DH-domain) 0.0000359
Further Details:      
 
Domain Number 2 Region: 289-417
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-26
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017612   Gene: ENSMPUG00000017723   Transcript: ENSMPUT00000017871
Sequence length 1372
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897126.1:1104455:1112983:-1 gene:ENSMPUG00000017723 transcript:ENSMPUT00000017871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGARGPNLSKPSPSLGRGPTGEVCDCAAVCESQTGPATPAMASPRGSGSSTSLSTVGS
EGDPAPGPTPVCSASRPEPLPGPPIRLHLSPVGTPGLAKPSRLERVVREIVETERAYVRD
LRSIVEDYLAPLMDGGVLGLSAEQVGMLFANIEDIYEFSSELLEDLEGSSSAGGIAECFV
QRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQRI
LKYHLLLQELGKHWAEGPGAGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRRL
GGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGPEYTYKGHI
FCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPA
KAKQVLLENSLHCAPKSKPIPEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSATRRGRR
QSEPVKEPYVMFPPNAKPRLKHTGSEGELYPPLEPQPPVPTSGPPEDLEDTGPPTLEPSG
TSITEEILELLNQRGLRDPGPSPHDIPKFSGDSQVPGDSETLTFRALPSRDSSEEEEEEE
LEMDERGPSPLHVLEGLESSSAAETTDVSGLSKSPDAPGLPEIPGLSEIPKIPHLPSLSD
ISSVFEMPRLPAIPNVPDIPSLASTPALPCDSWLQGPLQGPDEAVATRRELFPGGSSAKL
GEPSSGGRAGQEEPEEGEPFPDFQPQDVPQDQGFPDELEFRSCSEIRSAWRALEQGQLAR
PGFPEPLLILEDSDLGGGSGSRKAGAPSSERAASRVRELARLYSERIQQMQRAETRASAN
APRRRPRALAQPQLSPRLPQEHAEPVHTGPLPAFGHVLVCELAFPLTCAQESVPLGPAAR
VQAATPLSKQGGCPGGRGLSVSSLPEEDHLGIRVPAARRLSEQGDPQNIQSMTVSTTALP
PQEDPPDVQVLATALPDPGGHLEVQHPATTPLPQHRGHMDTQVPTSPALPGQRCCPDVTV
LATATVPKQEGPLHSQSPSNTPLTRQGGPRDVPFLAGVGNQAVDISLTHGSSLDRPIPGN
AALPSQHDLPDNIQFLGTSSLPAHECCLDHQLPASTALSLPQNSNVPAAAPLPQRPGLPD
TQVQALPPLPKQGGLPDTQGPSATPLLQEQSFTDLQIQKRSPLEQRSLSDVRGPAPTLLP
EQRGSRDSQGLFSTPAQTTMVLSKPGHYLASPVTRSESSELTPPHSPPLPTRQLLGPNAA
ALSRYLAASYISQSLARRQGSGGEAPLASRGPWSSSAPASRAPSPPPQPQPPPPPARRLS
YATTVNIHVGGGGRLRPAKAQVRLNHPALLAPAHESVGLRRAQGAPDAPFHM
Download sequence
Identical sequences M3Z200
ENSMPUP00000017612 ENSMPUP00000017612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]