SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017679 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000017679
Domain Number - Region: 312-427
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000264
Family APC10-like 0.097
Further Details:      
 
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily MPN010-like 0.0811
Family MPN010-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017679   Gene: ENSMPUG00000017791   Transcript: ENSMPUT00000017939
Sequence length 442
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:13964076:13970631:-1 gene:ENSMPUG00000017791 transcript:ENSMPUT00000017939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSPRPGSAKSPHKHTSNFYSDNSNSSVSVTSRDSSGQRSAGPGPGEPEGRRARGSSCG
EPALSAGVPGGTTWAGSSRQKPAPRSHNGQTACGAATVRGGASEPAGSPVASEEQLDLLS
TLDLRQEMPPPRVSKNFLSLLLQVLSVLLSLVGDALVIVYREVCSIRFLLTAVSLLSLFL
AALWWGLLYLVPPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSSVRAANS
ERVAKIVFQRLNEDFVRKPDYALSSVAPGASIDLEKTSHDYEDANTAYFWNRFSFWNYAR
PPTVILEPDVFPGNCWAFEGDQGQVVIRLPGRVQLSDVTLQHPPPSVAHTGGANSAPRDF
AVYGLQVDDETEVFLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLY
RVRAHGMRTSEGAGDSATGEPH
Download sequence
Identical sequences M3Z267
ENSMPUP00000017679 ENSMPUP00000017679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]