SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017782 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017782
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.11e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 219-365
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 121-229
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017782   Gene: ENSMPUG00000017892   Transcript: ENSMPUT00000018042
Sequence length 374
Comment pep:known scaffold:MusPutFur1.0:GL897128.1:501650:550081:-1 gene:ENSMPUG00000017892 transcript:ENSMPUT00000018042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERRRAVLELLQRPGNTRCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSI
RLDAWEEAQVEFMASHGNDAARDKYESKVPPFYYRPTSSDCQLLREQWIRAKYERQEFTH
PDKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGSLKYFNRNDAKEPKAIMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFVYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SKESGYTVLDGLPPSTQGHHWPHGITIVTPERRFLLACETEMEQRAWVEAFRKVVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences M3Z2H0
ENSMPUP00000017782 XP_004776374.1.14098 ENSMPUP00000017782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]