SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017962 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017962
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.05e-52
Family Cyclophilin (peptidylprolyl isomerase) 0.0000288
Further Details:      
 
Domain Number 2 Region: 223-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-28
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017962   Gene: ENSMPUG00000018073   Transcript: ENSMPUT00000018224
Sequence length 492
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896934.1:7287444:7322335:-1 gene:ENSMPUG00000018073 transcript:ENSMPUT00000018224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESVFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGDNLDYLD
GVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE
PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPSNLVLKDKVKPKQD
AKYDLVLDEQAEDSKSSHSHTSKKHKKKTRHCSEEKEDEDYMPIRNTNQDIYREMGFGHY
EEEESCWEKQKSEKRDRPQNRSRSRSRERDGHYSNSHKSKYQTDPYERERSKKRDRSRSP
KKSKDKEKSKYR
Download sequence
Identical sequences M3Z300 U6CSI7
ENSMPUP00000017962 XP_004752831.1.14098 ENSMPUP00000017962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]