SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019212 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019212
Domain Number 1 Region: 455-634
Classification Level Classification E-value
Superfamily SPOC domain-like 1.45e-49
Family SPOC domain 0.00033
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.19e-23
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019212   Gene: ENSMPUG00000019339   Transcript: ENSMPUT00000019491
Sequence length 636
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897233.1:748396:750306:-1 gene:ENSMPUG00000019339 transcript:ENSMPUT00000019491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDR
GRPYGYPAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPAR
GQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAA
LAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAE
ETRYPQQYQPSPLPVHYELLPDGYTRHRNLDADLRVRDRTPPHLLYSDRDRTFLEGDWTS
PSKSSDRRNSLEGYSRSVRSRSGERWGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEE
RSRTKGGGPQVDRGSDRTPERGRKENHSSDGTKECSSNSLSNSRHGAEERSHHHHHEAPD
SSHGKKTRESERNHRTAEAEAKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFP
TSMHILEGDQGVITGLLKDHTSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVL
LATQATPSGPGTEGMPAVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLY
AFPPCDFSQQYLQSALRTLGKLEEEHMVIVIVRDTA
Download sequence
Identical sequences M3Z6J9
ENSMPUP00000019212 ENSMPUP00000019212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]