SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000174 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000174
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-57
Family G proteins 0.0000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000174   Gene: ENSMPUG00000000177   Transcript: ENSMPUT00000000178
Sequence length 221
Comment pep:novel scaffold:MusPutFur1.0:GL896964.1:401373:417095:-1 gene:ENSMPUG00000000177 transcript:ENSMPUT00000000178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGNGTMTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQI
KLQIWDTAGQESFRSITRSYYRGAAGALLVYDITSRRETFNHLTSWLEDARQHSSSNMVI
MLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQG
LFDVHNEANGIKIGPQQCISTSVGTSASQRNSSEIGSDSGC
Download sequence
Identical sequences M3XM74
ENSMPUP00000000174 ENSMPUP00000000174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]