SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000226 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000226
Domain Number 1 Region: 9-406
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-118
Family Motor proteins 0.00000143
Further Details:      
 
Domain Number 2 Region: 1326-1640
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-53
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 973-1087
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000105
Family Prefoldin 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000226
Domain Number - Region: 444-553,592-633
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family Armadillo repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000226   Gene: ENSMPUG00000000229   Transcript: ENSMPUT00000000230
Sequence length 1662
Comment pep:known scaffold:MusPutFur1.0:GL897063.1:3547032:3699423:-1 gene:ENSMPUG00000000229 transcript:ENSMPUT00000000230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGAPDESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIESQ
QEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIIEEEQGIISRAVKH
LFKSIEEKKHTAIKNGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHED
STGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQTRMC
PQIDAENATDNKVISESSQLNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCG
LLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLN
TLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEYKTGKRIIDEEGVESIND
MFHENAMLQTENNNLRVRIKAMQETVDALRTRITQLVSDQANQVLARAGEGNEEISNMIH
SYIKEIEDLRAKLLESEAVNENLRKNLTRATARSPYFSGSSAFSPTILSSDKETIEIIDL
AKKDLEKLKRKEKKKKKSVAGKEDNTDTDQEKKEEKGITERENNELEVEESQEVSDHEEE
EEEEEEEEDDIEGGESSDESDSESDEKANYQADLANITCEIAIKQKLIDELENSQKRLQT
LKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQ
RLQTAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNR
EIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDRVAGKVTRKLS
SSDTPVQDAGSSAVAVEADVSRAGAQQKMRIPVARVQALPTPTTNGTRKKYQRKGLTGRV
FTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVK
ESGEGDKNVVNINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVSAVINACT
LTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAEL
NPELDALLGHALQDLDSVPLENVEDSTDEEAPLNSPGSEGSTLSSDLMKLCGEVKPKSKA
RRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELPP
PSGFPSKIGSISRQSSLSEKKLPEPSPITRRKAYEKTEKSKSKEQKHSDSGTSEASLSPP
SSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHSRSSRRGIINPFPASKGI
RTNPLQCLHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVS
VKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGEN
QINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCLTVDQISNGQDLIVT
GSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLAQ
KDLLQQVPNAHKDWVCALGVVPGHPVLLSGCRGGILKLWNVDTFVPVGEMKGHDSPINAI
CVNSTHIFTAADDRTVRIWKARSLQDGQISDLGDLGEDIAIN
Download sequence
Identical sequences M3XMC6
ENSMPUP00000000226 ENSMPUP00000000226 XP_004771890.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]