SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000283 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000283
Domain Number 1 Region: 77-349
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-73
Family Protein kinases, catalytic subunit 0.00000046
Further Details:      
 
Domain Number 2 Region: 1-36
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000333
Family PB1 domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000283   Gene: ENSMPUG00000000285   Transcript: ENSMPUT00000000287
Sequence length 371
Comment pep:known scaffold:MusPutFur1.0:GL896964.1:2194207:2451442:-1 gene:ENSMPUG00000000285 transcript:ENSMPUT00000000287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHDSPAVS
DSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVI
LLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPE
HVLGRIAIAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYV
GTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVD
EDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFIMQFNDGNATVVSMWVCRA
LEERRNQQGPP
Download sequence
Identical sequences M3XMI3
ENSMPUP00000000283 ENSMPUP00000000283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]