SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000347 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000347
Domain Number 1 Region: 258-469
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.65e-57
Family Reprolysin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 557-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000746
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 1205-1265
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000419
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 1078-1136
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000641
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 1023-1079
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 1306-1361
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 963-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 1360-1417
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 9 Region: 1420-1476
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 1156-1208
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 11 Region: 1471-1532
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000916
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 12 Region: 851-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000347
Domain Number - Region: 913-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0183
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000347   Gene: ENSMPUG00000000352   Transcript: ENSMPUT00000000354
Sequence length 1549
Comment pep:novel scaffold:MusPutFur1.0:GL897011.1:2570437:2717551:-1 gene:ENSMPUG00000000352 transcript:ENSMPUT00000000354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVARWLTGLLYQLSLFITRSWEIHFHPRQEALVRTLVSYEVVTPARVNEFGEVFPQSHH
FSRRKRSSEALEPAPFRTHYRISAYGQLFQLNLSADAAFLAAGYTEVHLGAPARGAERGV
VPPDLRHCFYRGQVNAREDHTAVFSLCGGLMGTFKAHDGEYFLEPIMKADGSEHEDDHNK
PHLIYRQELKSNYFLQSHKPCEVSESQIKQTTLPLHRNSNMTEDLNVKKEMALGYPSKNK
SLEDERSPLHSRKKRFLSYPRYVEVMVTADAKMVHHHGQNLQHYVLTLMSIVAAIYKDSS
IGNLINIVIVKLVVIHNEQEGPVISYNAATTLRNFCLWQQSQNVLDDAHPSHHDTAVLIT
REDICGAREKCDTLGLAELGTLCDPLRSCSISEENGLSAAFTIAHELGHVFNVPHDDSFK
CKETGIKHQYHVMAPTLNYHTSPWTWSKCSQKYITEFLDTGHGECLLDKPNGRIYDLSSQ
LPGLIYDVNKQCELMFGPGSQVCPYLKQCRRLWCTSAEGVHKGCRTQHMPLADGTNCGPG
MHCHHGLCVNKEMEARPVDGEWGPWGPYSSCSRTCGGGIKSTTRLCNRPEPRNGGKYCVG
RRMKFRSCNTDSCPKGKQDFREKQCSDFDGKHFNINGLSPNVRWLPKYSGIAIKDRCKLY
CRVAGTTNFYQLKDRVADGTPCGTETNDICVQGLCRQAGCDHVLNSKAKRDKCGVCGGDN
SSCRTMAGVFNSAHYGYNVVVKIPPGATNIDILQHSYSGKPEDDNYLALSDTQGNFLLNG
NFVVSMSKKEIHIQGAIFEYSGSNSSVERINSTDRLEEEVVLQVLCVGNLYNPDVRYSFS
IPVEEKSDLFTWDAYGPWQDCTKMCQGLHRRKITCIRKSDHMVVSDQRCDHLPLPLFVTE
KCNTDCELRWHIIGKSECSSHCGQGYRSLDVHCMRYSIHKGQTVLVDDRYCGDQLKPATR
ESCHGDCVLTRWHYSEWSQCSRSCGGGERSRESYCINNFGHRLANRECQELPRVTTENCN
EFSCPSWATSEWSECLVTCGKGTKQRQVWCQLNEDHLSHGLCNPSTKPESLRPCELHACA
SWQVGPWGSCTATCGRGYQMRAVKCVSELLSAVLDDRVCRGASRPSDRQDCMVIPCPVIP
KIGATSLPAVPIGKIAQWRHGSWTPCSVSCGQGNQARYVSCRDAYDAIADESHCAHLPRP
AEVSVCFNPCGEWQTGNWSPCSASCGHGKTTRQVLCISYHQPINENYCDPAVRPLIEQEC
NLAACPPMYSHFPSSSEQPSHFPGRNFPLTHKPEDHQNQGVHPSIRGNQWRTGPWGSCSS
SCGGGLQHRVVVCQDENGQSAHYCDTASRPPETQHCDSGPCPRWNYGSWGECTQTCGGGI
KSRFVICQFPNGQMSQEQNCEILNKPPSVVQCHVHACPDEVTWHRGPWKSCSASCGKGLK
YREVLCIDQFQGKIEEKYCSHLQKPRTQKACRSVRCPSWKANRWKECSVTCGSGVQQRDV
YCRLRGIGRVADEMCDPSTRPYFQRQCWQQDCDQYQWVAGQWLNVSTDP
Download sequence
Identical sequences M3XMP7
ENSMPUP00000000347 ENSMPUP00000000347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]