SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000376 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000376
Domain Number 1 Region: 423-865
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-118
Family RNB domain-like 0.000000099
Further Details:      
 
Domain Number 2 Region: 223-321,364-416
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-36
Family Cold shock DNA-binding domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 875-964
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000144
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000376   Gene: ENSMPUG00000000378   Transcript: ENSMPUT00000000383
Sequence length 1054
Comment pep:novel scaffold:MusPutFur1.0:GL896964.1:3462287:3499667:-1 gene:ENSMPUG00000000378 transcript:ENSMPUT00000000383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKREKVLLLRTFQGRTLRIVREHYLRPSVPCNSPLCPQPATCHNDGKLLSSDVTHYMI
PDWKVVQDYLEILEFPELKGIIFMQTACQTLQHQRGRRQYNKLRHLLKDARHDCVLFANE
FQQHCYHPRERGESMEKWQTRSIYRAAVWYYHHCQDKMPIVMVTEDEEAVQQYGSETEGV
FVISFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEYTEHLPLEVLEAGIKS
GRYIQGVLNVNKHRAQIEAFVRLQGASCKDSGLVSDILVHGMKARNRSIHGDVVVVELLP
KNEWKGRTAALCENDSDDKALGDPPSEPMPTGKVVGILQKNWRDYVVTFPSKEEVQSQGK
NAQKILVTPWDNRIPKIRISTQQTEALQDFRVVVRIDSWESTSLYPNGHFVRVLGRIGDL
EGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPEEERERKDLRETHLVFSIDPK
GCEDVDDTLSVRTLANGNLELGVHIADVTHFVPPNSYIDIEARTRAITYYLADRRYDMLP
SILSADLCSLLGGVDRYAVSVIWELDKTSYEIKTVWYSRTIIRSAYKLFYEAAQELLDGN
FHIVDDIPEFRDLDEKSRQAKLEELVWAIGKLTEIARHIRAKRDRCGALELEGVEIRVQL
DEKKNIHDLIPRQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPQQEFFSEL
RECAKAKGFFIDTRSNKTLADSLDNANDPNDPIVNRLLRSMATQAMSNALYFSTGSCAEE
EFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKDNLLSNKDLEELCRHI
NNRNRAAQHSQKQSTELFQCMYFKDKDPENEARCISDGVIYSIRTNGVLVFIPRFGIKGA
AYLRNKDGLVISCGSDSRSEWKPGSLQRFQNKITSTTTGGESVTFHLFDHVTVRISVQAS
RCHSDTIRLEIISNKPYLIPDKELFHQSSLLLKSDLVKEVTRSVEEAQLAQEVKVNVIQE
DYQKYCQTKGRSLYTLLEEIRDLALLDVSNSYGM
Download sequence
Identical sequences M3XMS6
ENSMPUP00000000376 ENSMPUP00000000376 XP_004758695.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]