SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000398 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000398
Domain Number 1 Region: 170-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-49
Family Nucleotide and nucleoside kinases 0.0000000144
Further Details:      
 
Domain Number 2 Region: 26-169
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-44
Family SH3-domain 0.000000088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000398   Gene: ENSMPUG00000000400   Transcript: ENSMPUT00000000405
Sequence length 473
Comment pep:novel scaffold:MusPutFur1.0:GL896909.1:6483652:6615503:-1 gene:ENSMPUG00000000400 transcript:ENSMPUT00000000405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGAL
DEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQK
RGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGP
SLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRS
SLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIK
SRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSS
TPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTADENYHNERA
RKSRNRLSSSSQHSRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL
Download sequence
Identical sequences M3XMU8
ENSMPUP00000000398 XP_012907379.1.14098 ENSMPUP00000000398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]