SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000472 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000472
Domain Number 1 Region: 8-135
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-34
Family G proteins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000472   Gene: ENSMPUG00000000478   Transcript: ENSMPUT00000000483
Sequence length 137
Comment pep:novel scaffold:MusPutFur1.0:GL897299.1:462238:500583:1 gene:ENSMPUG00000000478 transcript:ENSMPUT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNL
NVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKKVSEESET
QPLVALVGNKRDLPGLP
Download sequence
Identical sequences M3XN22
ENSMPUP00000000472 ENSMPUP00000000472 XP_004781610.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]