SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000499 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000499
Domain Number 1 Region: 308-395
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000732
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000499
Domain Number - Region: 223-285
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000157
Family Rhamnogalacturonase B, RhgB, middle domain 0.018
Further Details:      
 
Domain Number - Region: 492-550
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00149
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 
Domain Number - Region: 46-174
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.00248
Family Vitelline membrane outer protein-I (VMO-I) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000499   Gene: ENSMPUG00000000506   Transcript: ENSMPUT00000000511
Sequence length 1184
Comment pep:novel scaffold:MusPutFur1.0:GL896964.1:4511490:4525779:1 gene:ENSMPUG00000000506 transcript:ENSMPUT00000000511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKAWVFFFLVLEVTSVSGRQTMLTQSVRRVQPGRRTSSIFAKPVDSLESPGEWTTWF
NIDHPGGQGDYERLDAIQFYYGDRVCARPLRLEARTTDWMPAGSTGQVVHGSPREGFWCL
NREQQPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSSWSKCSAACGHTGVQTRTRTCLAE
TVSLCDEASEEGRLCMDEACTACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
ATVYLLTKKPKPLTKTDSSGRFRVPGLCPDGKSILKITKAKFAPIMLTMPKTSLKAATVN
AEFMRAETPYIVMNPETKARRAAQSVSLCCKAIGKPSPDKYFWYHNDTLLDPSLYKHESK
LVLRNLRQDQAGEYFCKAQSDSGAVKSRVAQLTVIATDETPCNPTPESYLIRLPHDCFQN
ATNSFYYDVGHCPVKTCAGQQDNGIRCRDAVEHCCGISKTEEREIQCSGYTLPTKVAMEC
SCQRCTETRSIVRGRVSAADNGEPMRFGHVYLGGNRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRKKEPITLEAMDTNIIPLGEVAGEDPMAE
LEIPSKSFYRQNGEPYTGKVKASVTFLDPRNISTATAAQSDLNFISDEGDTFPLRTYGMF
SVDFTDEATSESLNVGKVKVHLDSTQVKMPEHVPTMKLWSLNPDTGLWEEEGDFKFESQR
RGKREARTFLVGNMEIRERRLFNLDVPESRRCFIKVRAYRSERFLPSEQIQGVVVSVINL
EPRTGFSSNPRAWGRFDSVITGPNGACVPAFCDDESPDAYSAYVLASLAGEELEAVQSFP
KFNPNAIGVPQPYLNKLKYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPVEVNVRSRNMGGTHRRTVGKLYGIRDVKSTRDRDQPNVSSACLEFKCSGMLYDQDRV
DRTLVKVIPQGSCHRASVNSMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRVAKEIALGRCFDGTSDGSSRVMKSNVGVALTFNCVERQVGRQSAFQYLQSPSARP
PATNSGRGRMPSRRLQRASRRGQRRREAVASPRFLGLASQPRNN
Download sequence
Identical sequences M3XN49
ENSMPUP00000000499 ENSMPUP00000000499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]